PTM Viewer PTM Viewer

AT5G38630.1

Arabidopsis thaliana [ath]

cytochrome B561-1

No PTMs currently found

PLAZA: AT5G38630
Gene Family: HOM05D000998
Other Names: ACYB-1; CYB-1

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 230

MAVPVLGGFPIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVTPVSGKDQVLTQ

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR006593 14 218
Sites
Show Type Position
Active Site 51
Active Site 84
Active Site 118
Active Site 157
Active Site 77
Active Site 81
Active Site 140
Active Site 150
Active Site 151
Active Site 105
Active Site 106
Active Site 115
Active Site 182
Active Site 186

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here